PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf01096g00316.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 475aa    MW: 51807.6 Da    PI: 8.9716
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf01096g00316.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-1656100147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               r rWT+eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
  Peaxi162Scf01096g00316.1  56 RERWTEEEHKKFLEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 100
                               78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-1650104IPR009057Homeodomain-like
PROSITE profilePS5129421.47651105IPR017930Myb domain
TIGRFAMsTIGR015575.6E-1754103IPR006447Myb domain, plants
SMARTSM007172.5E-1355103IPR001005SANT/Myb domain
PfamPF002495.6E-145699IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-95696IPR009057Homeodomain-like
CDDcd001671.49E-1058101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
DQSGESGLDS IHSRRTQISS DVGASSARSI QLKEQVASAD EYAPKVRKPY TITKQRERWT  60
EEEHKKFLEA LKLYGRAWRR IEEHVGTKTA VQIRSHAQKF FSKVVRESNN DDTSSAKPIE  120
IPPPRPKRKP MHPYPRKLAT PIKSGTPVPE KSTRSVTPNM STSEQENQSP TSVLSAHGSD  180
ALGMGDSSKR SGSASPVSSA GGGNSGGFVL SESPNFISEN SSSPAQANAS ANPENKACVK  240
LELFPQDDDF VKQGSAETSS APRLKLFGKT VLVNESYRPS SPTSGVCKIE PDVNGEAALP  300
TVSWNLKPVN FTASDTECAS STLTRGTPTP FYYLPSQNEN RWSKECASAS LPCIQVLNPI  360
PIKGRPLFND KDLEDKQNQK EGSSTGSNTE PVGAEISEDK NMDIETQSSQ HPLDKVGKTL  420
SSFKRSETPS LVQRASSSKR MKGFVPYKRC LAESGINNST LTGEEREEQR TRLCL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016461216.10.0PREDICTED: protein REVEILLE 1-like isoform X1
TrEMBLM1BXP30.0M1BXP3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000552630.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31852447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.11e-53MYB_related family protein